PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ahy021215
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family GRAS
Protein Properties Length: 468aa    MW: 52437.4 Da    PI: 4.8397
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Ahy#S59558652PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS454.37.7e-139984682374
       GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqa 101
                ++ Ll+cA a+s+g++e+a+++++ l++ +s +g+p qR+aay++e+Laarla+s++ +ykal+++e++   ss++laa+++++ev+P++kf++++aN+a
  Ahy021215  98 RQMLLDCAVALSEGNQEAASSMINDLRQKVSIQGEPSQRIAAYMVEGLAARLAESGKCIYKALKCKEAP---SSDRLAAMQILFEVCPCFKFGFVAANNA 194
                689*****************************************************************9...9*************************** PP

       GRAS 102 IleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpg 199
                I eav+ +++vHiiDfdi+qG Q+++L+q LasR+++p ++R+Tgv++pes+  s   l+ +g+rL+k+Ae+lg+pfef++ v +r++ +++++L+++pg
  Ahy021215 195 ITEAVKDARKVHIIDFDINQGSQYINLIQILASRSRKPVHVRLTGVDDPESVqrSVGGLQIIGQRLEKLAEALGLPFEFQA-VPSRTSLVTPSMLNCHPG 293
                **************************************************9999999************************.7***************** PP

       GRAS 200 EalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvva 299
                Eal+Vn+++qlh+++desvs+ +erd++L+lvksl+Pk+v+vveq++++n+++Fl rf+ea +yysa+f+sl+++lpr+s++r++vEr++l+r+ivn+va
  Ahy021215 294 EALVVNFAFQLHHMPDESVSTVNERDQLLRLVKSLNPKLVTVVEQDVNTNTTPFLPRFVEAYNYYSAVFESLDVTLPRDSQDRMNVERQCLARDIVNIVA 393
                **************************************************************************************************** PP

       GRAS 300 cegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                ceg++r+er e ++kWr+r+++aGF++ p+s+++ ++++ + ++++ d y+v+ee+g+l +gW+d++L+++SaWr
  Ahy021215 394 CEGEDRIERYEVAGKWRARMTMAGFTSTPMSKNVSDEIRKMNKMHYYDKYNVKEEKGALHFGWEDKNLIVASAWR 468
                **********************************************999*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098565.31271448IPR005202Transcription factor GRAS
PfamPF035142.7E-13698468IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 468 aa     Download sequence    Send to blast
SGFSEIGNLD DQGLMRSRLK ALERRLLGQS DGEEEEEEED MFGTSQNMEI EQDISEWADS  60
IQNMLLQDSP KETSSSDSSL SSSISSNKEM SAIPQTPRQM LLDCAVALSE GNQEAASSMI  120
NDLRQKVSIQ GEPSQRIAAY MVEGLAARLA ESGKCIYKAL KCKEAPSSDR LAAMQILFEV  180
CPCFKFGFVA ANNAITEAVK DARKVHIIDF DINQGSQYIN LIQILASRSR KPVHVRLTGV  240
DDPESVQRSV GGLQIIGQRL EKLAEALGLP FEFQAVPSRT SLVTPSMLNC HPGEALVVNF  300
AFQLHHMPDE SVSTVNERDQ LLRLVKSLNP KLVTVVEQDV NTNTTPFLPR FVEAYNYYSA  360
VFESLDVTLP RDSQDRMNVE RQCLARDIVN IVACEGEDRI ERYEVAGKWR ARMTMAGFTS  420
TPMSKNVSDE IRKMNKMHYY DKYNVKEEKG ALHFGWEDKN LIVASAWR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-59994686375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016163426.10.0PREDICTED: scarecrow-like protein 1
SwissprotQ9SDQ30.0SCL1_ARATH; Scarecrow-like protein 1
TrEMBLA0A151TS870.0A0A151TS87_CAJCA; Scarecrow-like protein 1
STRINGGLYMA04G42090.20.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21450.10.0SCARECROW-like 1